GLUD1 antibody

• Catalog Number: orb579551
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GLUD1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Sheep, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61 kDa
• Target: GLUD1
• UniProt ID: P00367
• Protein Sequence: Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER
• NCBI: NP_005262
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GDH, GDH1, GLUD
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

GLUD1 antibody - N-terminal region (orb579551) validated by WB using Fetal Liver Lysate at 1 ug/ml.

Host: Rabbit, Target Name: GLUD1, Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: GLUD1, Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: GLUD1, Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: GLUD1, Sample Type: Human Fetal Liver, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Host: Rabbit, Target Name: GNAS, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: HIRIP3, Sample Type: 293T, Antibody dilution: 1.0 ug/ml. GLUD1 is supported by BioGPS gene expression data to be expressed in HEK293T.

Host: Rabbit, Target Name: NOP56, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: SERPINA3, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rat, Target Name: GLUD1, Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

Immunohistochemistry with cortex/kidney tissue.

Immunohistochemistry with pFa fixed human brain tissue.

Immunohistochemistry with pFA fixed human pancreas tissue tissue.

lanes 5: rat kidney cordex, lanes 6: rat kidney proximal tubules prepped from cortex, lanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysate, lanes 8: rat brain supernatant.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.