You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579550 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GLUD1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Sheep, Yeast, Zebrafish |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | GLUD1 |
UniProt ID | P00367 |
Protein Sequence | Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF |
NCBI | NP_005262 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GDH, GDH1, GLUD Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
GLUD1 antibody - N-terminal region (orb579550) validated by WB using HT1080 cell lysate at 1 ug/ml. GLUD1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.
Immunohistochemistry with CORTEX/KIDNEY tissue.
Immunohistochemistry with PFA fixed human colon tissue tissue.
Immunohistochemistry with pFA fixed human pancreas tissue tissue.
lanes 5: rat kidney cordex, lanes 6: rat kidney proximal tubules prepped from cortex, lanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysate, lanes 8: rat brain supernatant.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Sheep, Zebrafish | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Bovine, Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating