You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583364 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GLRX5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GLRX5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 16kDa |
Target | GLRX5 |
UniProt ID | Q86SX6 |
Protein Sequence | Synthetic peptide located within the following region: NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG |
NCBI | NP_057501 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GRX5, PRSA, SIDBA3, SPAHGC, FLB4739, PR01238, PRO1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: GLRX5, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: GLRX5, Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: GLRX5, Positive control (+): MCF7 (N10), Negative control (-): A549 (N03), Antibody concentration: 5 ug/ml.
WB Suggested Anti-GLRX5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.
Filter by Rating