GLP-1 (7-37)

• Catalog Number: orb1147101
• Category: Proteins
• Description: Endogenous GLP-1 receptor agonist; Peptides.
• CAS Number: 106612-94-6
• Form/Appearance: Freeze dried solid
• Purity: > 95% by hplc
• MW: 3355.71 Da
• Formula: C₁₅₁H₂₂₈N₄₀O₄₇
• Solubility (25°C): Soluble to 1 mg/ml in water
• Protein Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
• Storage: Store dry, frozen and in the dark
• Alternative names: Glucagon like peptide 1 fragment 7-37 (human)
• Note: For research use only
• Expiration Date: 12 months from date of receipt.