GLIS2 antibody

• Catalog Number: orb573560
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GLIS2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLIS2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56 kDa
• Target: GLIS2
• UniProt ID: Q9BZE0
• Protein Sequence: Synthetic peptide located within the following region: QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE
• NCBI: NP_115964
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NKL, NPHP7
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/ml.

Host: Rabbit, Target Name: GLIS2, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: GLIS2, Sample Tissue: Human Ovary Tumor, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target: GLIS2, Positive control (+): Human Ovary Tumor (T-OV), Negative control (-): Human Liver Tumor (T-LI), Antibody concentration: 3 ug/ml.

Sample Type: Human Bile DuctPrimary, dilution: 1:500.

WB Suggested Anti-GLIS2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.