You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574163 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GLI1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GLI1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 118 kDa |
Target | GLI1 |
UniProt ID | P08151 |
Protein Sequence | Synthetic peptide located within the following region: TNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEP |
NCBI | NP_005260 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GLI, PPD1, PAPA8 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-GLI1 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 118 kDa isoform is identified, a second isoform of 114 kDa, and a third isoform of 105 kDa are also present in some samples.
Host: Rabbit, Target Name: GLI1, Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: GLI1, Sample Type: HepG2 Whole Cell lysates, Antibody dilution: 0.5 ug/ml.
Host: Rabbit, Target Name: GLI1, Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 5.0 ug/ml.
WB Suggested Anti-GLI1 Antibody Titration: 1.0 ug/ml, Positive Control: HepG2 cell lysate.
FC, IF, IHC-P, WB | |
Bovine, Canine, Equine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating