GLI1 antibody

• Catalog Number: orb574163
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GLI1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GLI1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 118 kDa
• Target: GLI1
• UniProt ID: P08151
• Protein Sequence: Synthetic peptide located within the following region: TNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEP
• NCBI: NP_005260
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GLI, PPD1, PAPA8
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-GLI1 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 118 kDa isoform is identified, a second isoform of 114 kDa, and a third isoform of 105 kDa are also present in some samples.

Host: Rabbit, Target Name: GLI1, Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: GLI1, Sample Type: HepG2 Whole Cell lysates, Antibody dilution: 0.5 ug/ml.

Host: Rabbit, Target Name: GLI1, Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 5.0 ug/ml.

WB Suggested Anti-GLI1 Antibody Titration: 1.0 ug/ml, Positive Control: HepG2 cell lysate.