GHR/Growth Hormone R Protein, Rhesus macaque, Recombinant (His)

• Catalog Number: orb1977480
• Category: Proteins
• Description: Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway.; The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling. GHR Protein, Rhesus macaque, Recombinant (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 30.2 kDa and the accession number is P79194.
• Tag: C-6xHis
• Purity: 98.00%
• MW: 30.2 kDa (predicted)
• UniProt ID: P79194
• Protein Sequence: FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFY
• Expression System: E. coli
• Biological Origin: Rhesus
• Biological Activity: Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway.; The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling. GHR Protein, Rhesus macaque, Recombinant (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 30.2 kDa and the accession number is P79194.
• Expression Region: 19-264 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.