GGT1 monoclonal antibody (M01), clone 1F9

• Catalog Number: orb2292904
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GGT1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F9
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human, Mouse
• Isotype: IgG2a Kappa
• Immunogen: GGT1 (NP_005256, 381 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG
• NCBI: NP_005256
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GGT1 is 0.1 ng/ml as a capture antibody.

GGT1 monoclonal antibody (M01), clone 1F9 Western Blot analysis of GGT1 expression in NIH/3T3.

Immunoperoxidase of monoclonal antibody to GGT1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]

Immunoprecipitation of GGT1 transfected lysate using anti-GGT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GGT1 MaxPab rabbit polyclonal antibody.

Western Blot detection against Immunogen (35.64 KDa).