You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585603 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GDF5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of GDF5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 55kDa |
Target | GDF5 |
UniProt ID | P43026 |
Protein Sequence | Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP |
NCBI | NP_000548 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | OS5, LAP4, BDA1C, BMP14, CDMP1, LAP-4, SYM1B, SYNS Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: GDF5, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.
Rabbit Anti-GDF5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Pancreas, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-GDF5 Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating