GCH1 monoclonal antibody (M01), clone 4A12

• Catalog Number: orb2292911
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GCH1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4A12
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: GCH1 (NP_000152, 84 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIV
• NCBI: NP_000152
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GCH1 is approximately 0.3 ng/ml as a capture antibody.

GCH1 monoclonal antibody (M01), clone 4A12 Western Blot analysis of GCH1 expression in IMR-32.

Immunoperoxidase of monoclonal antibody to GCH1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]

Immunoprecipitation of GCH1 transfected lysate using anti-GCH1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GCH1 MaxPab rabbit polyclonal antibody.

Western Blot analysis of GCH1 expression in transfected 293T cell line by GCH1 monoclonal antibody (M01), clone 4A12. Lane 1: GCH1 transfected lysate (27.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.53 KDa).