You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292911 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant GCH1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4A12 |
Tested applications | ELISA, IHC-P, IP, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | GCH1 (NP_000152, 84 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | ENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIV |
NCBI | NP_000152 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged GCH1 is approximately 0.3 ng/ml as a capture antibody.
GCH1 monoclonal antibody (M01), clone 4A12 Western Blot analysis of GCH1 expression in IMR-32.
Immunoperoxidase of monoclonal antibody to GCH1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
Immunoprecipitation of GCH1 transfected lysate using anti-GCH1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GCH1 MaxPab rabbit polyclonal antibody.
Western Blot analysis of GCH1 expression in transfected 293T cell line by GCH1 monoclonal antibody (M01), clone 4A12. Lane 1: GCH1 transfected lysate (27.9 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.53 KDa).