You have no items in your shopping cart.
Cart summary
GCGR Peptide - middle region
Catalog Number: orb2001246
| Catalog Number | orb2001246 |
|---|---|
| Category | Proteins |
| Description | GCGR Peptide - middle region |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 54 kDa |
| UniProt ID | P47871 |
| Protein Sequence | Synthetic peptide located within the following region: RFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQV |
| NCBI | NP_000151.1 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | GGR, GL-R, Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
