GATA6 Rabbit Polyclonal Antibody

• Catalog Number: orb573932
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GATA6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GATA6
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 60kDa
• Target: GATA6
• UniProt ID: Q92908
• Protein Sequence: Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS
• NCBI: NP_005248
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ASD9, AVSD5, PACHD
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.

Rabbit Anti-GATA6 Antibody, Paraffin Embedded Tissue: Human Colon, Antibody Concentration: 5 ug/ml.

The cells are human embryonic stem cell line H1 differentiated to HNF4 positive hepatic progenitor cells. The antibodies were used at a 1:250 dilution.

WB Suggested Anti-GATA6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.