You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573929 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GATA2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GATA2 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 51 kDa |
Target | GATA2 |
UniProt ID | P23769 |
Protein Sequence | Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA |
NCBI | NP_116027 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | DCML, IMD21, NFE1B, MONOMAC Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: GATA2, Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: GATA2, Positive control (+): Hela (HL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.
Human Liver
Lane 1: 30 ug mouse liver lysate, Lane 2: 30 ug mouse N2a cell lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:2500, Gene Name: GATA2.
WB Suggested Anti-GATA2 antibody Titration: 1 ug/ml, Sample Type: Human K562.
WB Suggested Anti-GATA2 Antibody Titration: 1.0-2.0 ug/ml, ELISA Titer: 1:1562500, Positive Control: K562 cell lysate, GATA2 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells.
ELISA, IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating