Gastric Inhibitory Polypeptide (1-30) (porcine)

• Catalog Number: orb2693945
• Category: Proteins
• Description: Gastric Inhibitory Polypeptide (1-30), porcine lacks the C-terminal 12 amino acid residues of natural gastric inhibitory polypeptide (GIP), exhibits biologic activity by potentiating the release of insulin and somatostatin.
• CAS Number: 134875-67-5
• Purity: ≥95%
• MW: 3552.1
• Formula: C₁₆₂H₂₄₄N₄₀O₄₈S
• Target: Insulin Receptor
• Protein Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQK
• Note: For research use only
• Expiration Date: 6 months from date of receipt.