You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577465 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GAPDH |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Equine, Guinea pig, Rabbit |
Reactivity | Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GAPDH |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 36kDa |
Target | GAPDH |
UniProt ID | P04406 |
Protein Sequence | Synthetic peptide located within the following region: KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC |
NCBI | NP_002037 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | G3PD, GAPD, HEL-S-162eP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: GAPDH, Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: GAPDH, Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: GAPDH, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.
Host: Rat, Target Name: GAPDH, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.
Lanes: Lane 1-7: 30 ug rat heart extract, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:3000, Gene Name: GAPDH.
WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Transfected 293T.
WB Suggested Anti-GAPDH antibody Titration: 1 ug/ml, Sample Type: Human Raji.
ICC, IHC-P, IP, WB | |
Bacteria, Bovine, Canine, Drosophila, E. coli, Fish, Gallus, Hamster, Human, Insect, Mammal, Monkey, Mouse, Other, Plant, Porcine, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Canine, Human, Mouse, Porcine | |
Goat | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-P, WB | |
Canine, Gallus, Monkey, Rabbit, Sheep | |
Hamster, Human, Mouse, Porcine, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating