GAPDH Rabbit Polyclonal Antibody

• Catalog Number: orb577465
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GAPDH
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Rabbit
• Reactivity: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GAPDH
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: GAPDH
• UniProt ID: P04406
• Protein Sequence: Synthetic peptide located within the following region: KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
• NCBI: NP_002037
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: G3PD, GAPD, HEL-S-162eP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.

Lanes: Lane 1-7: 30 ug rat heart extract, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:3000, Gene Name: GAPDH.

WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Transfected 293T.

WB Suggested Anti-GAPDH antibody Titration: 1 ug/ml, Sample Type: Human Raji.