GAPDH Rabbit Polyclonal Antibody

• Catalog Number: orb577464
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GAPDH
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GAPDH
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36 kDa
• Target: GAPDH
• UniProt ID: Q2TSD0
• Protein Sequence: Synthetic peptide located within the following region: IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKW
• NCBI: NP_002037
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: G3PD, GAPD, HEL-S-162eP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 84 kDa.

Sample Type: 293T, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Sample Type: Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/ml. GAPDH is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

Lanes: 1. 50 ug NIH3T3 cytosolic extract 2. 50 ug NIH3T3 cytosolic extract 3. 50 ug NIH3T3 cytosolic extract 4. 50 ug NIH3T3 cytosolic extract, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:30000, Gene Name: GAPDH.

Rabbit Anti-GAPDH Antibody, Catalog Number: orb577464, Formalin Fixed Paraffin Embedded Tissue: Human Heart Muscle Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-GAPDH Antibody, Catalog Number: orb577464, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.

WB Suggested Anti-GAPDH antibody Titration: 1 ug/ml, Sample Type: Human Raji.