You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577464 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GAPDH |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GAPDH |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 36 kDa |
Target | GAPDH |
UniProt ID | Q2TSD0 |
Protein Sequence | Synthetic peptide located within the following region: IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKW |
NCBI | NP_002037 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | G3PD, GAPD, HEL-S-162eP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 84 kDa.
Host: Rabbit, Target Name: GAPDH, Sample Type: 293T, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Host: Rabbit, Target Name: GAPDH, Sample Type: Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/ml. GAPDH is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
Lanes: 1. 50 ug NIH3T3 cytosolic extract 2. 50 ug NIH3T3 cytosolic extract 3. 50 ug NIH3T3 cytosolic extract 4. 50 ug NIH3T3 cytosolic extract, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody Dilution: 1:30000, Gene Name: GAPDH.
Rabbit Anti-GAPDH Antibody, Catalog Number: orb577464, Formalin Fixed Paraffin Embedded Tissue: Human Heart Muscle Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-GAPDH Antibody, Catalog Number: orb577464, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.
WB Suggested Anti-GAPDH antibody Titration: 1 ug/ml, Sample Type: Human Raji.
ICC, IHC-P, IP, WB | |
Bacteria, Bovine, Canine, Drosophila, E. coli, Fish, Gallus, Hamster, Human, Insect, Mammal, Monkey, Mouse, Other, Plant, Porcine, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Canine, Human, Mouse, Porcine | |
Goat | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating