You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1215708 |
---|---|
Category | Proteins |
Description | The Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 (TL1A; VEGI) Biotinylated applications are for cell culture. Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 (TL1A; VEGI) Biotinylated Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 19.1 kDa |
Target | TNFSF15 |
Entrez | 417247 |
Protein Sequence | ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL |
Protein Length | 172 |
Source | Yeast |
Storage | -20°C |
Alternative names | TL1A Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating