Gallus CCL4 protein

Catalog Number: orb1216353

Catalog Number	orb1216353
Category	Proteins
Description	The Chicken CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN) (Gene ID: 395551).
Form/Appearance	Lyophilized
Purity	98%
MW	7.8 kDa
Target	CCL4
Entrez	395551
Protein Sequence	APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN
Protein Length	69
Source	Yeast
Storage	-20°C
Alternative names	MIP-1 beta Read more...
Note	For research use only
Expiration Date	6 months from date of receipt.