Gallus, Aves IGF-2 protein

• Catalog Number: orb1216310
• Category: Proteins
• Description: The Multi-species IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-species IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Multi-species IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Multi-species IGF-2 Specifications: (Molecular Weight: 7.5 kDa) (Amino Acid Sequence: YGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67)) (Gene ID: 100303676).
• Form/Appearance: Lyophilized
• Purity: 98%
• MW: 7.5 kDa
• Target: IGF-2
• Entrez: 100303676
• Protein Sequence: YGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67)
• Protein Length: 67
• Source: Yeast
• Storage: -20°C
• Alternative names: Somatomedin A
• Note: For research use only
• Expiration Date: 6 months from date of receipt.