You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580375 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GADD45B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GADD45B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 18kDa |
Target | GADD45B |
UniProt ID | O75293 |
Protein Sequence | Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
NCBI | NP_056490 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MYD118, GADD45BETA Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: GADD45B, Sample Tissue: Mouse Small Intestine, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: GA45B, Sample Type: Fetal Lung lysates, Antibody dilution: 3.0 ug/ml.
Host: Rabbit, Target Name: GADD45B, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: GADD45B, Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.
Sample Type: Human Prostate Cancer, Primary Antibody dilution: 2 ug/ml, Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue), Gene Name: GADD45B.
Sample Type: Human Prostate Cancer, Primary Antibody dilution: 2 ug/ml, Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue), Gene Name: GADD45B.
Sample Type: Human Prostate Cancer, Primary Antibody dilution: 2 ug/ml, Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue), Gene Name: GADD45B.
WB Suggested Anti-GADD45B Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
IF, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating