You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592786 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GABRD |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Mouse, Rabbit |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GABRD |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 51kDa |
Target | GABRD |
UniProt ID | O14764 |
Protein Sequence | Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG |
NCBI | NP_000806 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | EJM7, EIG10, GEFSP5 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: GABRD, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: GABRD, Sample Tissue: Human Fetal Kidney, Antibody Dilution: 1.0 ug/ml.
Human Muscle
Sample Type: Rat brain section, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-biotin, streptavidin-diaminobenzidine, Secondary Antibody Dilution: 1:500, Gene Name: GABRD.
WB Suggested Anti-GABRD Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating