You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329828 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GABRB3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GABRB3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 54 kDa |
Target | GABRB3 |
UniProt ID | P28472 |
Protein Sequence | Synthetic peptide located within the following region: ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA |
NCBI | NP_068712 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MGC9051 antibody, anti ECA5 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. In addition to the canonical 54 kDa isoform the peptide is present in a 58 kDa isoform and the protein is glycosylated.
Immunohistochemistry with Lung tissue at an antibody concentration of 5 ug/mL using anti-GABRB3 antibody (orb329828).
WB Suggested Anti-GABRB3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Liver.
AM, ICC, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, IHC | |
Bovine, Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IHC | |
Bovine, Canine, Mouse, Rat | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating