You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573674 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Gabra5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide corresponding to the middle region of mouse GABRA5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 52 kDa |
Target | Gabra5 |
UniProt ID | Q8BHJ7 |
Protein Sequence | Synthetic peptide located within the following region: WTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLK |
NCBI | NP_795916 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | A230018I05Rik Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Full length 52 kDa Gabra5 is cleaved to a mature 48 kDa form, and the protein is also subject to N-linked glycosylation.
Host: Rabbit, Target Name: GABRA5, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: GABRA5, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: Gabra5, Sample Tissue: Mouse Liver, Antibody dilution: 1.0 ug/ml.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-Gabra5 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse liver.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating