You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582741 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GABARAPL1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GABARAPL1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 14 kDa |
Target | GABARAPL1 |
UniProt ID | Q9H0R8 |
Protein Sequence | Synthetic peptide located within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL |
NCBI | NP_113600 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ATG8, GEC1, APG8L, ATG8B, ATG8L, APG8-LIKE Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein may be modified by lipidation.
Anti-GABARAPL1 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Host: Rabbit, Target Name: GABARAPL1, Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: GABARAPL1, Sample Type: Hela Whole Cell lysates, Antibody dilution: 1.0 ug/ml.
Immunohistochemistry with Human Brain lysate tissue at an antibody concentration of 5.0 ug/ml using anti-GABARAPL1 antibody (orb582741).
WB Suggested Anti-GABARAPL1 Antibody Titration: 1 ug/ml, Positive Control: 293T cells lysate. GABARAPL1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating