GAB1 monoclonal antibody (M01), clone 1B3

• Catalog Number: orb2292930
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GAB1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B3
• Tested applications: ELISA, IF, PLA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: GAB1 (NP_997006, 625 a.a. ~ 724 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPPKSVK
• NCBI: NP_997006
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to GAB1 on HeLa cell. [antibody concentration 40 ug/ml]

Proximity Ligation Analysis of protein-protein interactions between CRKL and GAB1. Mahlavu cells were stained with anti-CRKL rabbit purified polyclonal 1:1200 and anti-GAB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.74 KDa).