You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb389407 |
---|---|
Category | Antibodies |
Description | GAA Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 105324 MW |
UniProt ID | P10253 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Lysosomal alpha-glucosidase;3.2.1.20;Acid maltase; Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of GAA using anti-GAA antibody.Lane 1:human A549 cell;2:human HepG2 cell;3:human HEK293 cell;4:human PC-3 cell.
IHC analysis of GAA using anti-GAA antibody. GAA was detected in paraffin-embedded section of human liver cancer tissues.
IHC analysis of GAA using anti-GAA antibody. GAA was detected in paraffin-embedded section of human prostatic cancer tissues.
FC, ICC, IF, IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating