Cart summary

You have no items in your shopping cart.

    GAA Antibody (monoclonal, 2G7)

    Catalog Number: orb623772

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb623772
    CategoryAntibodies
    DescriptionGAA Antibody (monoclonal, 2G7)
    Species/HostMouse
    ClonalityMonoclonal
    Clone Number2G7
    Tested applicationsFC, ICC, IF, IHC, WB
    ReactivityHuman
    IsotypeMouse IgG2b
    ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW110 kDa, 95 kDa, 76 kDa
    UniProt IDP10253
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesLysosomal alpha-glucosidase;3.2.1.20
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
    Expiration Date12 months from date of receipt.
    GAA Antibody (monoclonal, 2G7)

    IF analysis of A549 cell using GAA antibody.

    GAA Antibody (monoclonal, 2G7)

    IF analysis of A549 cell using GAA antibody.

    GAA Antibody (monoclonal, 2G7)

    Immunohistochemical staining of human lung cancer tissue using GAA antibody.

    GAA Antibody (monoclonal, 2G7)

    Immunohistochemical staining of human mammary cancer tissue using GAA antibody.

    GAA Antibody (monoclonal, 2G7)

    Immunohistochemical staining of human prostatic cancer tissue using GAA antibody.

    GAA Antibody (monoclonal, 2G7)

    Western blot analysis of human A549 tissue lysates (Lane 1), human HEK293 whole cell lysates (Lane 2), human PC-3 whole cell lysates (Lane 3) using anti-GAA antibody

    GAA Antibody (monoclonal, 2G7)

    Flow Cytometry analysis of THP-1 cells using GAA antibody

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars