You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586015 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to G6PC3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human G6PC3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 39kDa |
Target | G6PC3 |
UniProt ID | Q9BUM1 |
Protein Sequence | Synthetic peptide located within the following region: ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT |
NCBI | NP_612396 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SCN4, UGRP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: G6PC3, Sample Type: Hela, Antibody dilution: 1.0 ug/ml. G6PC3 is strongly supported by BioGPS gene expression data to be expressed in HeLa.
Host: Rabbit, Target Name: G6PC3, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: G6PC3, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: G6PC3, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target: G6PC3, Positive control (+): MCF7 (N10), Negative control (-): Human Placenta (PL), Antibody concentration: 1 ug/ml.
WB Suggested Anti-G6PC3 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell. G6PC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating