G6PC antibody

• Catalog Number: orb579094
• Category: Antibodies
• Description: Rabbit polyclonal antibody to G6PC
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human G6PC
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40 kDa
• Target: G6PC
• UniProt ID: P35575
• Protein Sequence: Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
• NCBI: NP_000142
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: G6PC, G6PT, GSD1, GSD1a, G6Pase
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein is glycosylated.

Formalin Fixed Paraffin Embedded Tissue: Normal human kidney, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

Formalin Fixed Paraffin Embedded Tissue: Normal human liver, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

Host: Rabbit, Target Name: G6PC, Sample Tissue: Human HL-60 Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: G6PC, Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: G6PC, Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: G6PC, Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Host: Rabbit, Target: G6PC, Positive control (+): Human kidney (KI), Negative control (-): Human fetal heart (HE), Antibody concentration: 1 ug/ml.

Immunohistochemistry with Human kidney lysate tissue.

WB Suggested Anti-G6PC Antibody Titration: 1 ug/ml, Positive Control: Fetal Lung cell lysate.