G6pc antibody

• Catalog Number: orb579093
• Category: Antibodies
• Description: Rabbit polyclonal antibody to G6pc
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: G6pc
• UniProt ID: P35576
• Protein Sequence: Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI
• NCBI: NP_032087
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: G6P, G6pt, G6pc1, G6Pase, Glc-6-, AW107337, Glc-6-
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: G6PC, Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: G6pc, Sample Tissue: Mouse Lung, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: G6PC, Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-G6pc Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Intestine.