You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329937 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to G3BP1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IP, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human G3BP1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 52kDa |
Target | G3BP1 |
UniProt ID | Q13283 |
Protein Sequence | Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP |
NCBI | NP_005745 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti G3BP antibody, anti HDH-VIII antibody, anti M Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of HT1080 cell lysate tissue using G3BP1 antibody
Western blot analysis of NT2 CELL/BRAIN TISSUE tissue using G3BP1 antibody
Western blot analysis of human NT-2, mouse WT brain tissue using G3BP1 antibody
Western blot analysis of rat brain tissue using G3BP1 antibody
Amount and Sample Type: 500 ug rat brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: G3BP1, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:5000, Gene Name: G3BP1.
IP Suggested Anti-G3BP1 Antibody, Positive Control: NT2 CELL/BRAIN TISSUE.
Lanes: 1. Human NT-2 cells (60 ug) lysate 2. Mouse WT brain extract (80 ug), Primary Antibody Dilution: 2 ug/mL, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000, Gene Name: G3BP1.
Rabbit Anti-G3BP1 Antibody, Catalog Number: orb329937, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
WB Suggested Anti-G3BP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate, G3BP1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.
FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat | |
Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating