G3BP1 antibody

• Catalog Number: orb329937
• Category: Antibodies
• Description: Rabbit polyclonal antibody to G3BP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human G3BP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52kDa
• Target: G3BP1
• UniProt ID: Q13283
• Protein Sequence: Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP
• NCBI: NP_005745
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti G3BP antibody, anti HDH-VIII antibody, anti M
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HT1080 cell lysate tissue using G3BP1 antibody

Western blot analysis of NT2 CELL/BRAIN TISSUE tissue using G3BP1 antibody

Western blot analysis of human NT-2, mouse WT brain tissue using G3BP1 antibody

Western blot analysis of rat brain tissue using G3BP1 antibody

Amount and Sample Type: 500 ug rat brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: G3BP1, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:5000, Gene Name: G3BP1.

IP Suggested Anti-G3BP1 Antibody, Positive Control: NT2 CELL/BRAIN TISSUE.

Lanes: 1. Human NT-2 cells (60 ug) lysate 2. Mouse WT brain extract (80 ug), Primary Antibody Dilution: 2 ug/mL, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000, Gene Name: G3BP1.

Rabbit Anti-G3BP1 Antibody, Catalog Number: orb329937, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-G3BP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate, G3BP1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.