You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329936 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to G3BP1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human G3BP |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 51kDa |
Target | G3BP1 |
UniProt ID | Q13283 |
Protein Sequence | Synthetic peptide located within the following region: EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE |
NCBI | NP_005745 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti G3BP antibody, anti HDH-VIII antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of HepG2 tissue using G3BP1 antibody
Western blot analysis of HepG2 cell lysate tissue using G3BP1 antibody
Host: Rabbit, Target Name: G3BP, Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.
Host: Rabbit, Target: G3BP1, Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Liver (LI), Antibody concentration: 0.5 ug/mL.
WB Suggested Anti-G3BP Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IP, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Canine, Equine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating