FOXP3 Rabbit Polyclonal Antibody

• Catalog Number: orb574362
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FOXP3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: FOXP3
• UniProt ID: Q9BZS1
• Protein Sequence: Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL
• NCBI: NP_054728
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: JM2, AIID, IPEX, PIDX, XPID, DIETER
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Mouse Spleen frozen with positive lymphocytes / HPF (x400), Primary dilution: 1:100, Secondary Antibody: Vector Lab Goat Biotin-Conjugated Anti-Rabbit IgG, Secondary dilution: 1:100.

Sample Tissue: Human NCI-H226, Antibody dilution: 1.0 ug/ml.

Human Liver

WB Suggested Anti-FOXP3 Antibody Titration: 5.0-8.0 ug/ml, Positive Control: HepG2 cell lysate.