You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329742 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FOXP2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP2 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 80kDa |
Target | FOXP2 |
UniProt ID | O15409 |
Protein Sequence | Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA |
NCBI | NP_055306 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti CAGH44 antibody, anti DKFZp686H1726 antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-FOXP2 Antibody, Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/mL Magnification: 400X.
WB Suggested Antibody, Titration: 0.2-1 ug/mL, Positive Control: HepG2.
WB Suggested Anti-FOXP2 Antibody Titration: 0.5 ug/mL, Positive Control: HepG2 cell lysate.
ELISA, IHC | |
Bovine, Canine, Feline, Human, Mouse, Porcine, Rat, Zebrafish | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Bovine, Canine, Feline, Mouse, Porcine, Zebrafish | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating