FOXM1 antibody

• Catalog Number: orb592704
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FOXM1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXM1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 84kDa
• Target: FOXM1
• UniProt ID: Q08050
• Protein Sequence: Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ
• NCBI: NP_068772
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MPP2, HFH11, HNF-3, INS-1, MPP-2, PIG29, FKHL16, F
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-FOXM1 antibody (orb592704).

Host: Rabbit, Target Name: FOXM1, Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: FOXM1, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: FOXM1, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target: FOXM1, Positive control (+): HepG2 (HG), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/ml.

Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0 ug/ml using anti-FOXM1 antibody (orb592704).

Lanes: Lane 1: 25 ug MIA PaCa-2 human pancreatic cancer cell line Lane 2: 25 ug MDA-MB-231 cell lysate, Lane 3: 25 ug Huh-7 cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: FOXM1.

WB Suggested Anti-FOXM1 Antibody Titration: 1 ug/ml, Positive Control: Jurkat cell lysate.