You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592704 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FOXM1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Canine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FOXM1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 84kDa |
Target | FOXM1 |
UniProt ID | Q08050 |
Protein Sequence | Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ |
NCBI | NP_068772 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MPP2, HFH11, HNF-3, INS-1, MPP-2, PIG29, FKHL16, F Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-FOXM1 antibody (orb592704).
Host: Rabbit, Target Name: FOXM1, Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: FOXM1, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: FOXM1, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target: FOXM1, Positive control (+): HepG2 (HG), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/ml.
Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0 ug/ml using anti-FOXM1 antibody (orb592704).
Lanes: Lane 1: 25 ug MIA PaCa-2 human pancreatic cancer cell line Lane 2: 25 ug MDA-MB-231 cell lysate, Lane 3: 25 ug Huh-7 cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: FOXM1.
WB Suggested Anti-FOXM1 Antibody Titration: 1 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Sheep, Xenopus, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating