You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329956 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FOXC1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Mouse, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FOXC1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 57kDa |
Target | FOXC1 |
UniProt ID | Q12948 |
Protein Sequence | Synthetic peptide located within the following region: GGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYI |
NCBI | NP_001444 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ARA antibody, anti FKHL7 antibody, anti FREAC Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Colon, myenteric plexus.
Host: Rabbit, Target: FOXC1, Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 1 ug/mL.
WB Suggested Anti-FOXC1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: THP-1 cell lysate.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, WB | |
Bovine, Canine, Equine, Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating