You have no items in your shopping cart.
Cart summary
Item 1 of 6
Item 1 of 6
FOXA1 monoclonal antibody (M01), clone 2D7
Catalog Number: orb2292799
| Catalog Number | orb2292799 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant FOXA1. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 2D7 |
| Tested applications | ELISA, IHC-P, WB |
| Reactivity | Human |
| Isotype | IgG2a Kappa |
| Immunogen | FOXA1 (NP_004487, 367 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS |
| NCBI | NP_004487 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (37.4 KDa).
Detection limit for recombinant GST tagged FOXA1 is approximately 0.03 ng/ml as a capture antibody.
FOXA1 monoclonal antibody (M01), clone 2D7. Western Blot analysis of FOXA1 expression in HepG2.
Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
Western Blot analysis of FOXA1 expression in transfected 293T cell line by FOXA1 monoclonal antibody (M01), clone 2D7. Lane 1: FOXA1 transfected lysate (49.1 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of FOXA1 over-expressed 293 cell line, cotransfected with FOXA1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA1 monoclonal antibody (M01), clone 2D7 (Cat # orb2292799). GAPDH (36.1 kDa) used as specificity and loading control.
