FOXA1 antibody

• Catalog Number: orb583752
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FOXA1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXA1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 49 kDa
• Target: FOXA1
• UniProt ID: P55317
• Protein Sequence: Synthetic peptide located within the following region: MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTM
• NCBI: NP_004487
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HNF3A, TCF3A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

FOXA1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb583752 with 1:200 dilution. Western blot was performed using orb583752 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: FOXA1 IP with orb583752 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Host: Rabbit, Target Name: FOXA1, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. FOXA1 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. FOXA1 is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human liver.