FOXA1 antibody

• Catalog Number: orb574302
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FOXA1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish
• Reactivity: Bovine, Canine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FOXA1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 49kDa
• Target: FOXA1
• UniProt ID: Q0JTB6
• Protein Sequence: Synthetic peptide located within the following region: SFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASV
• NCBI: NP_004487
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HNF3A, TCF3A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: FOXA1, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Rabbit Anti-FOXA1 antibody, Catalog Number: orb574302, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclei in adipocytes but not in cardiomyocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-FOXA1 Antibody, Positive Control: Lane 1: 20 ug MCF7 cell lysates, Lane 2: 20 ug MCF7 cell lysates, Lane 3: 20 ug MCF7 cell lysate, s Lane 4: 20 ug MCF7 cell lysate, s Lane 5: 20 ug MCF7 with FoxA1 knockdown Lane 6: 20 ug MCF7 with FoxA1 knockdown, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2000. FOXA1 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human liver.