FOSL1 antibody

• Catalog Number: orb329599
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FOSL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOSL1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29kDa
• Target: FOSL1
• UniProt ID: P15407
• Protein Sequence: Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK
• NCBI: NP_005429
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FRA1 antibody, anti fra-1 antibody, anti FRA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Skin tissue using FOSL1 antibody

Immunohistochemical staining of human Lung tissue using FOSL1 antibody

Immunohistochemical staining of human Lung tissue using FOSL1 antibody

Western blot analysis of Jurkat cell lysate tissue using FOSL1 antibody

Immunohistochemical staining of human Skin tissue using FOSL1 antibody

Human Skin

Host: Rat, Target Name: FOSL1, Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: FOSL1, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Immunohistochemistry with Human Skin lysate tissue at an antibody concentration of 5.0 ug/mL using anti-FOSL1 antibody (orb329599).

Rabbit Anti-FOSL1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Rabbit Anti-FOSL1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Rabbit Anti-FOSL1 Antibody, Catalog Number: orb329599, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-FOSL1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.