You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586381 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FOLR2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human FOLR2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 31 kDa |
Target | FOLR2 |
UniProt ID | P14207 |
Protein Sequence | Synthetic peptide located within the following region: LCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNA |
NCBI | NP_000794 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FBP, FOLR1, FR-P3, FRbeta, FR-BETA, BETA-HFR, FBP/ Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/ml. Multiple isoforms of this protein are known and several share the peptide sequence.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-FOLR2 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell. FOLR2 is supported by BioGPS gene expression data to be expressed in MCF7.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating