You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578055 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FOLR1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FOLR1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 30 kDa |
Target | FOLR1 |
UniProt ID | P15328 |
Protein Sequence | Synthetic peptide located within the following region: HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF |
NCBI | NP_000793 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FBP, FOLR, NCFTD, FRalpha Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. FOLR1 is modified via glycosylation and processed to a mature form.
Host: Rabbit, Target Name: FOLR1, Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: FOLR1, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 5 ug/ml.
Host: Rabbit, Target Name: FOLR1, Sample Type: PANC1 Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.
Rabbit Anti-FOLR1 Antibody, Catalog Number: orb578055, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane and cytoplasmic in alveolar type I & II cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-FOLR1 Antibody, Catalog Number: orb578055, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Membrane in bile ducts not in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-FOLR1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: PANC1 cell lysate. FOLR1 is supported by BioGPS gene expression data to be expressed in PANC1.
WB Suggested Anti-FOLR1 antibody Titration: 1 ug/ml, Sample Type: Human liver.
ELISA, FA, FACS, Kinetics | |
Human | |
Monoclonal | |
Unconjugated |
ELISA, FA, FACS, Kinetics | |
Human | |
Monoclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating