FMOD antibody

• Catalog Number: orb582408
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FMOD
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Equine, Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FMOD
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 43kDa
• Target: FMOD
• UniProt ID: Q06828
• Protein Sequence: Synthetic peptide located within the following region: VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER
• NCBI: NP_002014
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FM, SLRR2E
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: FMOD, Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: FMOD, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 3 ug/ml.

Host: Rabbit, Target Name: FMOD, Sample Tissue: Human RPMI 8226 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: FMOD, Sample Tissue: Human U937 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target: FMOD, Positive control (+): 293T (2T), Negative control (-): Human kidney (KI), Antibody concentration: 1 ug/ml.

Sample Type: Equine Cartilage Explants, Primary dilution: 1:500.

WB Suggested Anti-FMOD Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.