FMNL3 antibody

Catalog Number: orb586314

Catalog Number	orb586314
Category	Antibodies
Description	Rabbit polyclonal antibody to FMNL3
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	WB
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
Reactivity	Human
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human FMNL3
Concentration	0.5 mg/ml
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
MW	50kDa
Target	FMNL3
UniProt ID	Q8IVF7
Protein Sequence	Synthetic peptide located within the following region: RFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQ
NCBI	NP_783863.4
Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names	FRL2, WBP3, FHOD3, WBP-3 Read more...
Note	For research use only
Expiration Date	12 months from date of receipt.

Host: Rabbit, Target Name: FMNL2, Sample Type: OVCAR-3 Whole cell lysates, Antibody dilution: 1.0 ug/ml.