You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579371 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FKTN |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FKTN |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 51kDa |
Target | FKTN |
UniProt ID | O75072 |
Protein Sequence | Synthetic peptide located within the following region: TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL |
NCBI | NP_001073270 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FCMD, CMD1X, LGMD2M, MDDGA4, MDDGB4, MDDGC4, LGMDR Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human Muscle
WB Suggested Anti-FKTN Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.
Filter by Rating