FKBP5 monoclonal antibody (M02), clone 3D1-1B10

• Catalog Number: orb2293030
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant FKBP5.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D1-1B10
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: FKBP5 (AAH42605, 1 a.a. ~ 457 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
• NCBI: AAH42605
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FKBP5 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to FKBP5 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (76.01 KDa).