FKBP4 monoclonal antibody (M01), clone 5C11

• Catalog Number: orb2293033
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FKBP4.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5C11
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: FKBP4 (AAH07924, 301 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKL
• NCBI: AAH07924
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FKBP4 is approximately 1 ng/ml as a capture antibody.

FKBP4 monoclonal antibody (M01), clone 5C11 Western Blot analysis of FKBP4 expression in HeLa.

FKBP4 monoclonal antibody (M01), clone 5C11. Western Blot analysis of FKBP4 expression in NIH/3T3.

FKBP4 monoclonal antibody (M01), clone 5C11. Western Blot analysis of FKBP4 expression in PC-12.

FKBP4 monoclonal antibody (M01), clone 5C11. Western Blot analysis of FKBP4 expression in Raw 264.7.

Immunoperoxidase of monoclonal antibody to FKBP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 0.5 ug/ml]

Immunoprecipitation of FKBP4 transfected lysate using anti-FKBP4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FKBP4 MaxPab rabbit polyclonal antibody.

Western Blot detection against Immunogen (37.84 KDa).