FKBP4 Rabbit Polyclonal Antibody

• Catalog Number: orb573594
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FKBP4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Porcine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52kDa
• Target: FKBP4
• UniProt ID: P30416
• Protein Sequence: Synthetic peptide located within the following region: ANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA
• NCBI: NP_002005
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HBI, p52, Hsp56, FKBP51, FKBP52, FKBP59, PPIase
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

FKBP4 antibody - C-terminal region (orb573594), Catalog Number: orb573594, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-FKBP4 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate, FKBP4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.