Cart summary

You have no items in your shopping cart.

    Fibrinogen beta chain/FGB Antibody (monoclonal, 6D12)

    Catalog Number: orb692232

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb692232
    CategoryAntibodies
    DescriptionFibrinogen beta chain/FGB Antibody (monoclonal, 6D12)
    Species/HostMouse
    ClonalityMonoclonal
    Clone Number6D12
    Tested applicationsIHC, WB
    ReactivityHuman
    IsotypeMouse IgG2b
    ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW56 kDa
    UniProt IDP02675
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Fibrinogen beta chain/FGB Antibody (monoclonal, 6D12)

    Western blot analysis of Fibrinogen beta chain/FGB using anti-Fibrinogen beta chain/FGB antibody (orb692232). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human HEPG2 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Fibrinogen beta chain/FGB antigen affinity purified monoclonal antibody (Catalog # orb692232) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90502) with Tanon 5200 system. A specific band was detected for Fibrinogen beta chain/FGB at approximately 56KD. The expected band size for Fibrinogen beta chain/FGB is at 56KD.

    Fibrinogen beta chain/FGB Antibody (monoclonal, 6D12)

    IHC analysis of Fibrinogen beta chain/FGB using anti-Fibrinogen beta chain/FGB antibody (orb692232). Fibrinogen beta chain/FGB was detected in paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Fibrinogen beta chain/FGB Antibody (orb692232) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90443) with DAB as the chromogen.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars