You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb389404 |
---|---|
Category | Antibodies |
Description | Fibrinogen beta chain/FGB Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 55928 MW |
UniProt ID | P02675 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Fibrinogen beta chain;Fibrinopeptide B;Fibrinogen Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of HepG2 cells using anti-Fibrinogen beta chain/FGB antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.
WB analysis of Fibrinogen beta chain/FGB using anti-Fibrinogen beta chain/FGB antibody.Lane 1:human HepG2 cell;2:rat kidney tissue;3:rat liver tissue;4:mouse kidney tissue;5:mouse liver tissue.
IF analysis of Fibrinogen beta chain/FGB using anti-Fibrinogen beta chain/FGB antibody. Fibrinogen beta chain/FGB was detected in an immunocytochemical section of A549 cells.
IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating